PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c25_3170V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 487aa    MW: 53579.6 Da    PI: 5.7276
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c25_3170V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171562148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT++Ed++lv +++++G g+W++ +++ g+ R++k+c++rw +yl
  Pp3c25_3170V3.1.p 15 KGPWTPDEDQKLVAYIQEHGHGSWRALPEKAGLARCGKSCRLRWTNYL 62
                       79********************************************97 PP

2Myb_DNA-binding54.13.5e-1768113148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rgr++ eEd+ ++++++ lG++ W++Ia +++  Rt++++k++w+++l
  Pp3c25_3170V3.1.p  68 RGRFSHEEDQMIIQLHAILGNR-WSAIAGHLP-QRTDNEIKNYWNTHL 113
                        89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0521062IPR017930Myb domain
SuperFamilySSF466896.24E-3112109IPR009057Homeodomain-like
SMARTSM007171.6E-131464IPR001005SANT/Myb domain
PfamPF002493.0E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-241669IPR009057Homeodomain-like
CDDcd001671.89E-111762No hitNo description
PROSITE profilePS5129426.40663117IPR017930Myb domain
SMARTSM007172.9E-1667115IPR001005SANT/Myb domain
PfamPF002491.8E-1568113IPR001005SANT/Myb domain
CDDcd001675.04E-1270113No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion